PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00476.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 289aa    MW: 32303.4 Da    PI: 6.2465
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00476.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+d+++ +G+g+W+  ++  g+ R++k+c++rw +yl
  Rsa1.0_00476.1_g00017.1 14 KGPWTPEEDQKLIDYIRVHGPGNWRILPKNAGLQRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding54.33.2e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr++ eE+e +++++  +G++ W++Ia++++ gRt++++k++w+++
  Rsa1.0_00476.1_g00017.1  67 RGRFSFEEEETIIQLHSVMGNK-WSAIAARLP-GRTDNEIKNHWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.497965IPR017930Myb domain
SuperFamilySSF466891.8E-3111108IPR009057Homeodomain-like
SMARTSM007171.9E-141363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001677.34E-131661No hitNo description
Gene3DG3DSA:1.10.10.607.4E-2765117IPR009057Homeodomain-like
PROSITE profilePS5129421.00966116IPR017930Myb domain
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1567111IPR001005SANT/Myb domain
CDDcd001672.08E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRLPCCDKN GVKKGPWTPE EDQKLIDYIR VHGPGNWRIL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVMGNKWS AIAARLPGRT DNEIKNHWNT HIRKRLVRSG  120
IDPVTHSPRL DLLDLSSLLA AILNQPNFSS VASHASSLLN PDVLRLASLL LPPQQPLPNP  180
NTLYASNLDQ NLQTPNTSVS SQDTQPQAEC TTPTKDETSY FEPVNARLEV GPSDVLPPLS  240
ESLDLDSLMS TPNYSPQQNN IEAEANYSSS LFDFGFPDNL TFDGFMGLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765480.0KR076548.1 Brassica napus MYB transcription factor 41 (MYB41.1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013673934.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLM4EBX20.0M4EBX2_BRARP; Uncharacterized protein
STRINGBra026281.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.11e-133myb domain protein 41